Anti-IDH1, IgG2a, Clone: [CL0219], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90578
- Bilder (11)
| Artikelname: | Anti-IDH1, IgG2a, Clone: [CL0219], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB90578 |
| Hersteller Artikelnummer: | AMAb90578 |
| Alternativnummer: | ATA-AMAB90578-100,ATA-AMAB90578-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Pan-Cancer |
| isocitrate dehydrogenase 1 (NADP+), soluble |
| Anti-IDH1 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.1 |
| Klon-Bezeichnung: | [CL0219] |
| Isotyp: | IgG2a |
| NCBI: | 3417 |
| UniProt: | O75874 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IDH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunofluorescence staining of A-431 cells using the anti-IDH1 monoclonal antibody, showing specific staining in the cytosol and nuclear bodies in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Immunohistochemical staining of human kidney shows strong positivity in a subset of renal tubules. |
|
|
Immunohistochemical staining of human testis shows strong immunoreactivity in seminiferous tubules. |
|
|
Immunohistochemical staining of human prostate shows strong positivity in glandular epithelium. |
|
|
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line RT-4 |
|
|
AMAb90578 |
|
|
|
|
|
|
|
|
AMAb90578 |
|
|
AMAb90578 |
Produktgarantie und fachkundiger Support
