Anti-GFAP Antibody 100ul, IgG1, Clone: [CL2713], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB91033
Article Name: Anti-GFAP Antibody 100ul, IgG1, Clone: [CL2713], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB91033
Supplier Catalog Number: AMAb91033
Alternative Catalog Number: ATA-AMAB91033-100,ATA-AMAB91033-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ45472
glial fibrillary acidic protein
Anti-GFAP
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL2713]
Isotype: IgG1
NCBI: 2670
UniProt: P14136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GFAP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the hippocampus.
Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the cerebellum.
Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the cerebellum.
Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the brainstem.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using AMAb91033 antibody. Corresponding GFAP RNA-seq data are presented for the same tissues.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GFAP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
Western blot analysis in mouse cerebral cortex tissue.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Mouse Cerebral Cortex tissue
AMAb91033
AMAb91033
AMAb91033