IL4R (Interleukin-4 Receptor Subunit alpha, IL-4 Receptor Subunit alpha, IL-4R Subunit alpha, IL-4R-alpha, IL-4RA, CD124, IL4RA, 582J2.1, Soluble Interleukin-4 Receptor Subunit alpha, Soluble IL-4 Receptor Subunit alpha, Soluble I

Artikelnummer: USB-128472-PE
Artikelname: IL4R (Interleukin-4 Receptor Subunit alpha, IL-4 Receptor Subunit alpha, IL-4R Subunit alpha, IL-4R-alpha, IL-4RA, CD124, IL4RA, 582J2.1, Soluble Interleukin-4 Receptor Subunit alpha, Soluble IL-4 Receptor Subunit alpha, Soluble I
Artikelnummer: USB-128472-PE
Hersteller Artikelnummer: 128472-PE
Alternativnummer: USB-128472-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: Partial recombinant protein corresponding to aa26-135 from human L4R with GST tag. MW of the GST tag alone is 26kD.
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1D3]
NCBI: 000418
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).