SLC11A2 (Solute Carrier Family 11 Member 2, DCT1, DMT1, NRAMP2, Natural Resistance-associated Macrophage Protein 2, Divalent Cation Transporter 1, Divalent Metal Transporter 1, FLJ37416) (MaxLight 490), Clone: [4C6], Mouse, Monocl

Artikelnummer: USB-133397-ML490
Artikelname: SLC11A2 (Solute Carrier Family 11 Member 2, DCT1, DMT1, NRAMP2, Natural Resistance-associated Macrophage Protein 2, Divalent Cation Transporter 1, Divalent Metal Transporter 1, FLJ37416) (MaxLight 490), Clone: [4C6], Mouse, Monocl
Artikelnummer: USB-133397-ML490
Hersteller Artikelnummer: 133397-ML490
Alternativnummer: USB-133397-ML490-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa1-66 from human SLC11A2 (NP_000608) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. Solute carrier family 11, member 2 (SLCA2) also known as divalent metal ion transporter 1 (DMT1) imports Fe2+ via a proton-coupled, membrane potential dependent manner. It can also transport a variety of other divalent metal cations including Mn2+, Co2+, Cu2+, and Zn2+ but iron appears to be its most important physiological substrate. SLC11A2 has been demonstrated on the apical membrane of duodenal enterocytes, transferrin cycle endosomes in erythroid precursors, hepatocytes where it has been postulated to be involved in non-transferrin-bound iron uptake, and placenta where it has been implicated in transfer of iron from mother to fetus. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4C6]
NCBI: 000617
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)490.