RARRES2 (Retinoic Acid Receptor Responder Protein 2, CHEMERIN, HP10433, TIG2), Clone: [4B12], Mouse, Monoclonal

Artikelnummer: USB-368321
Artikelname: RARRES2 (Retinoic Acid Receptor Responder Protein 2, CHEMERIN, HP10433, TIG2), Clone: [4B12], Mouse, Monoclonal
Artikelnummer: USB-368321
Hersteller Artikelnummer: 368321
Alternativnummer: USB-368321-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: RARRES2 (NP_002880.1, aa17-163) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B12]
NCBI: 002880
UniProt: Q99969
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.