Anti-OPG [AbAb01OPG], Rabbit, Monoclonal

Produktübersicht

• Artikelname: Anti-OPG [AbAb01OPG], Rabbit, Monoclonal
• Artikelnummer: ABA-AB04113-23.0-BT
• Hersteller Artikelnummer: Ab04113-23.0-BT
• Alternativnummer: ABA-AB04113-23.0-BT
• Hersteller: Absolute Antibody
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA
• Spezies Reaktivität: Human
• Alternative Synonym: Osteoprotegerin, OCIF, PDB5, TR1, TNFRSF11B, Tumor necrosis factor receptor superfamily member 11b, TNF receptor superfamily member 11b, Osteoclastogenesis inhibitory factor

Produktbeschreibung

The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [AbAb01OPG]
• UniProt: O00300
• Puffer: PBS only.
• Target-Kategorie: OPG