Anti-Caspase-3 [4F-6], IgG1, Mouse, Monoclonal

Artikelnummer: ABA-AB04219-1.1-BT
Artikelname: Anti-Caspase-3 [4F-6], IgG1, Mouse, Monoclonal
Artikelnummer: ABA-AB04219-1.1-BT
Hersteller Artikelnummer: Ab04219-1.1-BT
Alternativnummer: ABA-AB04219-1.1-BT
Hersteller: Absolute Antibody
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, NeA, WB
Spezies Reaktivität: Human
Alternative Synonym: CASP-3, CPP-32, SCA-1, EC:3.4.22.56, Apopain, Cysteine protease CPP32, Protein Yama
The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
Klonalität: Monoclonal
Klon-Bezeichnung: [4F-6]
Isotyp: IgG1
UniProt: P42574
Puffer: PBS only.
Target-Kategorie: Caspase-3