Anti-Dcp1a Antibody [ARC1421], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A10006-100
Artikelname: Anti-Dcp1a Antibody [ARC1421], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A10006-100
Hersteller Artikelnummer: A10006-100
Alternativnummer: ABC-A10006-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1421] antibody to Dcp1a.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1421]
Molekulargewicht: 73 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: PVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Target-Kategorie: Dcp1a
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200