Anti-Werners syndrome helicase WRN Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10013-50
Artikelname: Anti-Werners syndrome helicase WRN Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10013-50
Hersteller Artikelnummer: A10013-50
Alternativnummer: ABC-A10013-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1223-1432 of human WRN (NP_000544.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Werners syndrome helicase WRN.
Klonalität: Polyclonal
Molekulargewicht: 200 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: CQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Target-Kategorie: Werners syndrome helicase WRN
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:1,000