Anti-Asialoglycoprotein Receptor 1 / HL-1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10017-100
Artikelname: Anti-Asialoglycoprotein Receptor 1 / HL-1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10017-100
Hersteller Artikelnummer: A10017-100
Alternativnummer: ABC-A10017-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ASGR1 (NP_001662.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Asialoglycoprotein Receptor 1 / HL-1.
Klonalität: Polyclonal
Molekulargewicht: 33 kDa / 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSE
Target-Kategorie: Asialoglycoprotein Receptor 1 / HL-1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200