Anti-Aspartate beta hydroxylase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10018-50
Artikelname: Anti-Aspartate beta hydroxylase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10018-50
Hersteller Artikelnummer: A10018-50
Alternativnummer: ABC-A10018-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 81-270 of human ASPH (NP_001158227.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Aspartate beta hydroxylase.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT
Target-Kategorie: Aspartate beta hydroxylase
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:100