Anti-ERCC8 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10020-100
Artikelname: Anti-ERCC8 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10020-100
Hersteller Artikelnummer: A10020-100
Alternativnummer: ABC-A10020-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human ERCC8 (NP_000073.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ERCC8.
Klonalität: Polyclonal
Molekulargewicht: 44 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: SCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
Target-Kategorie: ERCC8
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000