Anti-Dio3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10023-100
Artikelname: Anti-Dio3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10023-100
Hersteller Artikelnummer: A10023-100
Alternativnummer: ABC-A10023-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Dio3.
Klonalität: Polyclonal
Molekulargewicht: 34 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: HFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTU
Target-Kategorie: Dio3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000