Anti-HLA DMA Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10027-100
Artikelname: Anti-HLA DMA Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10027-100
Hersteller Artikelnummer: A10027-100
Alternativnummer: ABC-A10027-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-233 of human HLA-DMA (NP_006111.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to HLA DMA.
Klonalität: Polyclonal
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC
Target-Kategorie: HLA DMA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000