Anti-Superoxide Dismutase 3 / EC-SOD Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10038-100
Artikelname: Anti-Superoxide Dismutase 3 / EC-SOD Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10038-100
Hersteller Artikelnummer: A10038-100
Alternativnummer: ABC-A10038-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOD3 (NP_003093.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Superoxide Dismutase 3 / EC-SOD.
Klonalität: Polyclonal
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALE
Target-Kategorie: Superoxide Dismutase 3 / EC-SOD
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200