Anti-NPFF Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10045-100
Artikelname: Anti-NPFF Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10045-100
Hersteller Artikelnummer: A10045-100
Alternativnummer: ABC-A10045-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 34-113 of human NPFF (NP_003708.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NPFF.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequenz: AEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
Target-Kategorie: NPFF
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000