Anti-Cyclin E2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10048-100
Artikelname: Anti-Cyclin E2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10048-100
Hersteller Artikelnummer: A10048-100
Alternativnummer: ABC-A10048-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 255-404 of human Cyclin E2 (NP_477097.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Cyclin E2.
Klonalität: Polyclonal
Molekulargewicht: 47 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Target-Kategorie: Cyclin E2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200