Anti-Nuclear Receptor Corepressor NCoR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10050-100
Artikelname: Anti-Nuclear Receptor Corepressor NCoR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10050-100
Hersteller Artikelnummer: A10050-100
Alternativnummer: ABC-A10050-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NCOR1 (NP_006302.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Nuclear Receptor Corepressor NCoR.
Klonalität: Polyclonal
Molekulargewicht: 270 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQIL
Target-Kategorie: Nuclear Receptor Corepressor NCoR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:100