Anti-TOX Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10052-100
Artikelname: Anti-TOX Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10052-100
Hersteller Artikelnummer: A10052-100
Alternativnummer: ABC-A10052-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human TOX (NP_055544.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TOX.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQLINSKPSVFHGPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPPLQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQAMEYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT
Target-Kategorie: TOX
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IHC: 1:50-1:200