Anti-REST / NRSF Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10072-100
Artikelname: Anti-REST / NRSF Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10072-100
Hersteller Artikelnummer: A10072-100
Alternativnummer: ABC-A10072-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human REST/NRSF (NP_005603.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to REST / NRSF.
Klonalität: Polyclonal
Molekulargewicht: 150 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEERQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGA
Target-Kategorie: REST / NRSF
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500