Recombinant SARS-CoV-2 Spike Protein (B.1.1.7 Variant) (Functional)

Artikelnummer: ABC-A270600-100
Artikelname: Recombinant SARS-CoV-2 Spike Protein (B.1.1.7 Variant) (Functional)
Artikelnummer: ABC-A270600-100
Hersteller Artikelnummer: A270600-100
Alternativnummer: ABC-A270600-100
Hersteller: Antibodies.com
Kategorie: Proteine/Peptide
Applikation: Functional Studies, IA, SDS-PAGE, WB
Alternative Synonym: sars-cov-2
Full-length soluble protein with foldon trimerization motif, mutated Furin recognition site and 4 stabilising mutations (A892P, A942P, K986P and V987P), based on/modified from Amanat et al, 2020 (PMID: 32398876) and Hsieh et al, 2020 (PMID: 32703906).
Konzentration: Lot specific.
Tag: His Tag (8xHis at the C-terminus).
Puffer: Supplied in Phosphate Buffered Saline with 20% Glycerol.
Expression System: HEK293 cells.
Reinheit: > 95% (by SDS-PAGE).
Formulierung: Liquid
Sequenz: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAISGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQP
Target-Kategorie: SARS-CoV-2 Spike Protein