Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A305449-100
| Artikelname: |
Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A305449-100 |
| Hersteller Artikelnummer: |
A305449-100 |
| Alternativnummer: |
ABC-A305449-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1174-1273 of SARS-CoV-2 Spike S2 (YP_009724390.1). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S2. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
36 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Formulierung: |
Liquid |
| Sequenz: |
ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT |
| Target-Kategorie: |
SARS-CoV-2 Spike Glycoprotein S2 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:1,000, IP: 1:1,000-1:5,000 |
