Anti-SARS-CoV-2 Spike Glycoprotein S2 ECD Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A305898-100
Artikelname: Anti-SARS-CoV-2 Spike Glycoprotein S2 ECD Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A305898-100
Hersteller Artikelnummer: A305898-100
Alternativnummer: ABC-A305898-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, ICC, IP, WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of SARS-CoV-2 Spike S2 ECD (YP_009724390.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S2 ECD.
Klonalität: Polyclonal
Molekulargewicht: 75 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: FNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
Target-Kategorie: SARS-CoV-2 Spike Glycoprotein S2 ECD
Antibody Type: Primary Antibody
Application Verdünnung: DB: 1:500-1:2,000, WB: 1:2,000-1:6,000, ICC/IF: 1:50-1:200, IP: 1:2,000-1:6,000