Anti-TMPRSS2 Antibody [ARC1439], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306933-50
Artikelname: Anti-TMPRSS2 Antibody [ARC1439], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306933-50
Hersteller Artikelnummer: A306933-50
Alternativnummer: ABC-A306933-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMPRSS2 (O15393).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1439] antibody to TMPRSS2.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1439]
Molekulargewicht: 52 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAAL
Target-Kategorie: TMPRSS2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200