Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A308100-100
Artikelname: |
Anti-SARS-CoV-2 Spike Glycoprotein RBD (N501Y) Antibody [ARC52673], Unconjugated, Rabbit, Monoclonal |
Artikelnummer: |
ABC-A308100-100 |
Hersteller Artikelnummer: |
A308100-100 |
Alternativnummer: |
ABC-A308100-100 |
Hersteller: |
Antibodies.com |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Virus |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 450-550 of coronavirus SARS-CoV-2 Spike RBD (N501Y) (YP_009724390.1). |
Konjugation: |
Unconjugated |
Rabbit monoclonal [ARC52673] antibody to SARS-CoV-2 Spike Glycoprotein RBD (N501Y). |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC52673] |
Molekulargewicht: |
36 kDa |
Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
Formulierung: |
Liquid |
Sequenz: |
NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG |
Target-Kategorie: |
SARS-CoV-2 Spike Glycoprotein RBD (N501Y) |
Antibody Type: |
Primary Antibody |
Application Verdünnung: |
WB: 1:1,000-1:5,000 |