Anti-JTB Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8615-100
Artikelname: Anti-JTB Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8615-100
Hersteller Artikelnummer: A8615-100
Alternativnummer: ABC-A8615-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-105 of human JTB (NP_006685.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to JTB.
Klonalität: Polyclonal
Molekulargewicht: 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Target-Kategorie: JTB
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000