Anti-TREM2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8628-100
Artikelname: Anti-TREM2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8628-100
Hersteller Artikelnummer: A8628-100
Alternativnummer: ABC-A8628-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TREM2.
Klonalität: Polyclonal
Molekulargewicht: 30 - 50 kDa / 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Target-Kategorie: TREM2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200