Anti-PRMT10 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A8632-100
| Artikelname: |
Anti-PRMT10 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A8632-100 |
| Hersteller Artikelnummer: |
A8632-100 |
| Alternativnummer: |
ABC-A8632-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PRMT9 (NP_612373.2). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to PRMT10. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
105 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Formulierung: |
Liquid |
| Sequenz: |
MSNSRPRSRRDAGGGAGAAGRDELVSRSLQSAEHCLGVQDFGTAYAHYLLVLSLAPELKHDVKETFQYTLFRWAEELDALSRIQDLLGCYEQALELFPDDEVICNSMGEHLFRMGFRDEAAGYFHKAVKLNPDFSDAKENFYRVANWLVERWHFIMLNDTKRNTIYNAAI |
| Target-Kategorie: |
PRMT10 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:1,000-1:2,000 |
