Anti-FbxO6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8694-50
Artikelname: Anti-FbxO6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8694-50
Hersteller Artikelnummer: A8694-50
Alternativnummer: ABC-A8694-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-260 of human FBXO6 (NP_060908.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FbxO6.
Klonalität: Polyclonal
Molekulargewicht: 34 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: QPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPK
Target-Kategorie: FbxO6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200