Anti-Cytochrome b245 Light Chain / p22-phox Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8752-100
Artikelname: Anti-Cytochrome b245 Light Chain / p22-phox Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8752-100
Hersteller Artikelnummer: A8752-100
Alternativnummer: ABC-A8752-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Cytochrome b245 Light Chain / p22-phox.
Klonalität: Polyclonal
Molekulargewicht: 22 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
Target-Kategorie: Cytochrome b245 Light Chain / p22-phox
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200