Anti-CACNA1H Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8755-100
Artikelname: Anti-CACNA1H Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8755-100
Hersteller Artikelnummer: A8755-100
Alternativnummer: ABC-A8755-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1890-2030 of human CACNA1H (NP_066921.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CACNA1H.
Klonalität: Polyclonal
Molekulargewicht: 259 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SARRVDADRPPLPQESPGARDAPNLVARKVSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS
Target-Kategorie: CACNA1H
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200