Anti-GABARAPL2 / GATE-16 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87554-100
Artikelname: Anti-GABARAPL2 / GATE-16 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87554-100
Hersteller Artikelnummer: A87554-100
Alternativnummer: ABC-A87554-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL2 (NP_009216.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GABARAPL2 / GATE-16.
Klonalität: Polyclonal
Molekulargewicht: 17 - 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL
Target-Kategorie: GABARAPL2 / GATE-16
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000