Anti-COMT Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87559-100
Artikelname: Anti-COMT Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87559-100
Hersteller Artikelnummer: A87559-100
Alternativnummer: ABC-A87559-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-221 of human COMT (NP_009294.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to COMT.
Klonalität: Polyclonal
Molekulargewicht: 25 kDa / 30 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: VGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Target-Kategorie: COMT
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IP: 1:50-1:100