Anti-SRAP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87567-100
Artikelname: Anti-SRAP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87567-100
Hersteller Artikelnummer: A87567-100
Alternativnummer: ABC-A87567-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRA1 (NP_001030312.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SRAP.
Klonalität: Polyclonal
Molekulargewicht: 26 kDa / 37 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
Target-Kategorie: SRAP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000