Anti-LSAMP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87568-100
Artikelname: Anti-LSAMP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87568-100
Hersteller Artikelnummer: A87568-100
Alternativnummer: ABC-A87568-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of human LSAMP (NP_002329.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to LSAMP.
Klonalität: Polyclonal
Molekulargewicht: 37 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRD
Target-Kategorie: LSAMP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000