Anti-Asparagine synthetase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87581-100
Artikelname: Anti-Asparagine synthetase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87581-100
Hersteller Artikelnummer: A87581-100
Alternativnummer: ABC-A87581-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 262-561 of human ASNS (NP_597680.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Asparagine synthetase.
Klonalität: Polyclonal
Molekulargewicht: 55 / 64 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: DSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEG
Target-Kategorie: Asparagine synthetase
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:200