Anti-SEPN1 / SELN Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87582-100
Artikelname: Anti-SEPN1 / SELN Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87582-100
Hersteller Artikelnummer: A87582-100
Alternativnummer: ABC-A87582-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 341-590 of human SEPN1 (NP_065184.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SEPN1 / SELN.
Klonalität: Polyclonal
Molekulargewicht: 66 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VDMEWLYGASESSNMEVDIGYIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEPLQFVFEEIKWQQELSWEEAARRLEVAMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILTLLNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP
Target-Kategorie: SEPN1 / SELN
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000