Anti-MTA1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87593-100
Artikelname: Anti-MTA1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87593-100
Hersteller Artikelnummer: A87593-100
Alternativnummer: ABC-A87593-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MTA1 (NP_004680.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MTA1.
Klonalität: Polyclonal
Molekulargewicht: 78 - 82 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: LMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Target-Kategorie: MTA1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000