Anti-Flt3 / CD135 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87612-100
Artikelname: Anti-Flt3 / CD135 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87612-100
Hersteller Artikelnummer: A87612-100
Alternativnummer: ABC-A87612-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 650-750 of human FLT3 (NP_004110.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Flt3 / CD135.
Klonalität: Polyclonal
Molekulargewicht: 118 - 155 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSD
Target-Kategorie: Flt3 / CD135
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000