Anti-DHX57 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87613-100
Artikelname: Anti-DHX57 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87613-100
Hersteller Artikelnummer: A87613-100
Alternativnummer: ABC-A87613-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-900 of human DHX57 (NP_945314.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DHX57.
Klonalität: Polyclonal
Molekulargewicht: 150 - 155 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: SATLNAELFSDYFNSCPVITIPGRTFPVDQFFLEDAIAVTRYVLQDGSPYMRSMKQISKEKLKARRNRTAFEEVEEDLRLSLHLQDQDSVKDAVPDQQLDFKQLLARYKGVSKSVIKTMSIMDFEKVNLELIEALLEWIVDGKHSYPPGAILVFLPGLAEIKMLYEQLQSNSLFNNRRSNRCVIHPLHSSLSSEEQQAVFV
Target-Kategorie: DHX57
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000