Anti-MRPS14 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87619-100
Artikelname: Anti-MRPS14 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87619-100
Hersteller Artikelnummer: A87619-100
Alternativnummer: ABC-A87619-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPS14 (NP_071383.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MRPS14.
Klonalität: Polyclonal
Molekulargewicht: 15 - 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
Target-Kategorie: MRPS14
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000, ICC/IF: 1:50-1:200