Anti-ZNF581 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87624-100
Artikelname: Anti-ZNF581 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87624-100
Hersteller Artikelnummer: A87624-100
Alternativnummer: ABC-A87624-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ZNF581.
Klonalität: Polyclonal
Molekulargewicht: 22 - 24 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCP
Target-Kategorie: ZNF581
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200