Anti-CD3 epsilon Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87625-100
Artikelname: Anti-CD3 epsilon Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87625-100
Hersteller Artikelnummer: A87625-100
Alternativnummer: ABC-A87625-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CD3E Antigen (NP_000724.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CD3 epsilon.
Klonalität: Polyclonal
Molekulargewicht: 23 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Target-Kategorie: CD3 epsilon
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200