Anti-GSTM5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87628-100
Artikelname: Anti-GSTM5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87628-100
Hersteller Artikelnummer: A87628-100
Alternativnummer: ABC-A87628-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human GSTM5 (NP_000842.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GSTM5.
Klonalität: Polyclonal
Molekulargewicht: 24 - 26 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Target-Kategorie: GSTM5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100