Anti-THEM4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87629-100
Artikelname: Anti-THEM4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87629-100
Hersteller Artikelnummer: A87629-100
Alternativnummer: ABC-A87629-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 37-150 of human THEM4 (NP_444283.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to THEM4.
Klonalität: Polyclonal
Molekulargewicht: 25 kDa / 27 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: SSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGF
Target-Kategorie: THEM4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200