Anti-ST3GAL4 / STZ Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87638-100
Artikelname: Anti-ST3GAL4 / STZ Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87638-100
Hersteller Artikelnummer: A87638-100
Alternativnummer: ABC-A87638-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-267 of human ST3GAL4 (NP_006269.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ST3GAL4 / STZ.
Klonalität: Polyclonal
Molekulargewicht: 34 - 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: REDSFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALH
Target-Kategorie: ST3GAL4 / STZ
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000