Anti-BST2 / Tetherin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87641-100
Artikelname: Anti-BST2 / Tetherin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87641-100
Hersteller Artikelnummer: A87641-100
Alternativnummer: ABC-A87641-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 49-161 of human BST2 (NP_004326.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to BST2 / Tetherin.
Klonalität: Polyclonal
Molekulargewicht: 35 - 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Target-Kategorie: BST2 / Tetherin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200