Anti-Caspase-1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A87644-100
Artikelname: |
Anti-Caspase-1 Antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
ABC-A87644-100 |
Hersteller Artikelnummer: |
A87644-100 |
Alternativnummer: |
ABC-A87644-100 |
Hersteller: |
Antibodies.com |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 120-297 of human Caspase-1 (NP_150634.1). |
Konjugation: |
Unconjugated |
Rabbit polyclonal antibody to Caspase-1. |
Klonalität: |
Polyclonal |
Molekulargewicht: |
48 kDa / 20 - 25 kDa |
Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Formulierung: |
Liquid |
Sequenz: |
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD |
Target-Kategorie: |
Caspase-1 |
Antibody Type: |
Primary Antibody |
Application Verdünnung: |
WB: 1:100-1:500 |