Anti-Caspase-1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87644-100
Artikelname: Anti-Caspase-1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87644-100
Hersteller Artikelnummer: A87644-100
Alternativnummer: ABC-A87644-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-297 of human Caspase-1 (NP_150634.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Caspase-1.
Klonalität: Polyclonal
Molekulargewicht: 48 kDa / 20 - 25 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Target-Kategorie: Caspase-1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500