Anti-ACE2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87864-100
Artikelname: Anti-ACE2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87864-100
Hersteller Artikelnummer: A87864-100
Alternativnummer: ABC-A87864-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ACE2 (NP_068576.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ACE2.
Klonalität: Polyclonal
Molekulargewicht: 100 kDa / 120 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: GDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
Target-Kategorie: ACE2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200