Anti-RNF31 / HOIP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87886-50
Artikelname: Anti-RNF31 / HOIP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87886-50
Hersteller Artikelnummer: A87886-50
Alternativnummer: ABC-A87886-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human RNF31 (NP_060469.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to RNF31 / HOIP.
Klonalität: Polyclonal
Molekulargewicht: 120 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: AAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECA
Target-Kategorie: RNF31 / HOIP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100